PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30131.m007019
Common NameLOC8285296, RCOM_1446420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family NAC
Protein Properties Length: 242aa    MW: 27242 Da    PI: 9.9879
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30131.m007019genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM131.46.5e-41141371128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                    lp G+rFhPtdeelvv+yL++kv g +l++ +vi+e+d+++++Pw+Lp  +   +++ yfFs++  ++ +++r++ra+ sgyWk tgk ++++++ 
  30131.m007019  14 LPIGYRFHPTDEELVVHYLRRKVFGFPLPA-SVIPELDVFQTDPWNLPGDL---KEKRYFFSRKLGNE-SENRNRRAAGSGYWKPTGKGRPIIASf 104
                    699***************************.99***************554...45789999998766.578999******************998 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    +++ vgl+kt+ f +g++p+ +kt+W+mheyrl
  30131.m007019 105 GNHIVGLRKTFLFCEGKNPNESKTQWIMHEYRL 137
                    8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.02E-498165IPR003441NAC domain
PROSITE profilePS5100547.88214165IPR003441NAC domain
PfamPF023655.0E-2415137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MEKSNLVANG GMKLPIGYRF HPTDEELVVH YLRRKVFGFP LPASVIPELD VFQTDPWNLP  60
GDLKEKRYFF SRKLGNESEN RNRRAAGSGY WKPTGKGRPI IASFGNHIVG LRKTFLFCEG  120
KNPNESKTQW IMHEYRLVGS GTLLNTSQVF KLNLGDWVVY RVFQKKRRSK KQGTISKSSS  180
TCSEVMSSSF MEFTMVECSD VGPQPSSPCS SGITEVSSNG LDQEETSSSI SFSFHSCKRK  240
ST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-3781719174Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1163170QKKRRSKK
2164169KKRRSK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002512886.10.0PREDICTED: NAC domain-containing protein 83
SwissprotQ9FY931e-56NAC83_ARATH; NAC domain-containing protein 83
TrEMBLB9RH270.0B9RH27_RICCO; Transcription factor, putative
STRINGPOPTR_0001s33260.12e-90(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.13e-57NAC domain containing protein 83